PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN18558.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 471aa    MW: 51763.7 Da    PI: 6.698
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN18558.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.3e-39116176262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++k l+cprC+s++tkfCyynny+++qPryfCkaC+ryWt+GG++rnvPvG+grrknk+s+
  KHN18558.1 116 PDKVLPCPRCKSMDTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVPVGAGRRKNKNST 176
                 78999*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-29109173IPR003851Zinc finger, Dof-type
PfamPF027013.2E-32117174IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.537120174IPR003851Zinc finger, Dof-type
PROSITE patternPS013610122158IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MHEIRDPAIR LFGQKIPFPE DVDKEEESAE DREQEMEEHE DEGDKDTRVE NVTKEELEAD  60
PPLDAEETKI SGTSPEAIVN PKTPSIEEET AKSKGGKSEK EQGDAANSQE KTLKKPDKVL  120
PCPRCKSMDT KFCYYNNYNV NQPRYFCKAC QRYWTAGGTM RNVPVGAGRR KNKNSTSHYR  180
HITISEALQA ARIDAQNGTH LPTLKGNGRV LSFGLDAHAP ICDSMASLMN LGEKKALNGT  240
RNGFHHGFED QRLPVPCKSG ENGDDSSTTS SITISSPKGE NNKSTFQQQP LPQNHGFLPQ  300
VPCIPGVPWP YTWNSPVPPP ALCPSGFPLP FYPATFWNCG MPGNWNVPWF SSSSPASNLK  360
SPSSSPNSPT LGKHSRDSDM IKQDSLHKEE ASTPRNGSVL VPKTLRIDDP SEAAKSSIWA  420
TLGIKNESVS GGAMFKAFQS KKGEKNHVEA SPMLMANPAA LSRSLNFHEN S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939480.0BT093948.1 Soybean clone JCVI-FLGm-24D21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304489.10.0cyclic dof factor 3
SwissprotQ8LFV31e-126CDF3_ARATH; Cyclic dof factor 3
TrEMBLK7MKW70.0K7MKW7_SOYBN; Uncharacterized protein
STRINGGLYMA17G10920.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-113cycling DOF factor 3